PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G32350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 312aa    MW: 32291.7 Da    PI: 8.2836
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G32350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.3e-3958117261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  ONIVA02G32350.1  58 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 117
                      7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3157116IPR003851Zinc finger, Dof-type
PfamPF027013.2E-3359116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22762116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAGAPPMHIC MDSDWLKGIV PEEHGMGSSS PSAELIACPR APMQAAAAAA DRRLRPQHDQ  60
PLKCPRCEST HTKFCYYNNY SLSQPRYFCK TCRRYWTKGG SLRNVPVGGG CRKNKRAPPK  120
KAAAHAQPAV AVAAALQGRH METGLHLSFS GMQHHLAPPP PPAATAADPL CSLGLFDWKQ  180
YDPVFAGSGG GGSPVAALES AGGSEAQFMG AGMMGIGGGG GGGVAEYHAL SALRYAAGLG  240
DHLALPFGAG RAEHDAVEVK PVAAERLLSL EWCGEASRTA APESSISSLG GLGLWSGMIG  300
GGHHHHGSSA AI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623280.11e-174PREDICTED: dof zinc finger protein DOF3.1
TrEMBLA0A0E0GBY00.0A0A0E0GBY0_ORYNI; Uncharacterized protein
STRINGBGIOSGA005764-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-35Dof family protein